PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G179500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 360aa    MW: 37221.8 Da    PI: 8.5005
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G179500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702218.61.4e-671392983153
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                          sgt++CqdCGnqakkdC+h+RCRtCCksrg+dC+thvkstWvpaa+rrerq ++aaa   a +s +++  k++r   +++++++s+t++s
  Manes.01G179500.1.p 139 SGTTTCQDCGNQAKKDCSHRRCRTCCKSRGYDCTTHVKSTWVPAARRRERQLMAAAAGGGAGSSGSTSGVKKPRLI-NSQTTTTSHTSTS 227
                          7899***********************************************9999999999999999999999986.788899999**** PP

               DUF702  93 saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                          +++++++++tss          lP +v+++avf+cvrv++vd ge+e+aYq++v+igGhvfkG+LydqG+e
  Manes.01G179500.1.p 228 NTTPPRSFDTSSshqdasfkdaLPGKVRAPAVFKCVRVTAVDGGEDEYAYQAVVKIGGHVFKGFLYDQGVE 298
                          **********999********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.0E-61141298IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-26143185IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.1E-29250297IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGMFVVAPAA SFNHHHHHHQ HQHLHQHESS INLSDPINGP NAATTALGVG MGVGVIPLLT  60
AAPCLSPQNM DDQDLLNNGR NKISGIQFWQ NQTSNHHSQY NLKKTSASIL DHNNSSGNLL  120
QSGNNTSSAG GIGGNSASSG TTTCQDCGNQ AKKDCSHRRC RTCCKSRGYD CTTHVKSTWV  180
PAARRRERQL MAAAAGGGAG SSGSTSGVKK PRLINSQTTT TSHTSTSNTT PPRSFDTSSS  240
HQDASFKDAL PGKVRAPAVF KCVRVTAVDG GEDEYAYQAV VKIGGHVFKG FLYDQGVEGR  300
DGFPNISELH LGGGSSSGGG GDGGGRNGAS SSPIIDPTDV YGASGGGLLG GSSYGNPIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530898.11e-160PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK98e-85LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB9SY291e-160B9SY29_RICCO; Transcription factor, putative
STRINGPOPTR_0009s07510.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.24e-71Lateral root primordium (LRP) protein-related